$100,000 Bio Hunt
Sequence ID:ENST00000424912
Seqence Name:11:64570982:64578766:-1
Based Sequence (Protein):MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPE
LTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKK
VSDVIWNSLSRSYFKDRAHIQSLFSF
Compared Sequence1 (Intron1):GTAGGCATCTTTATATGTTAACAGACACTGATACCCAGCTAAAGCGGCTGAACACATTTA
CTCTCTGGCAGTGTTTAAAAGTATCTGTTTTTCTCATATTGTTTTATTTTAATTTTTTCT
GGATCAAG
Compared Sequence2 (Intron2):GTGCCCCCGGACTACATTTTCCAGAAGGCACTGCGGGCACGCTTCCTGCCTGGTCGGCCT
GAAGGGAAGGGCCAATCCCTGAGTATCTCGGGAAGGAGGTGTCCGGAGCCGCGGACCTAG
AGATCCCAGAAGCCACAGCGCAGCGGCCCGGCCCGCCACTATTTCCAGGCTCAGCGGGGC
AGGGGTGGGCCCAGACTCCACTTCCCGGCGGGTAGTGCGACCCTAGGGGCGGGACTTCAT
GTCCCAGCAGGCTCCGGGCGGCGTGCGCCGCGGTGCCTAGTGTGGGATGTAAGCGCGGAG
GTGGGCGAGGGGGACCGAGGCCAGGACTCTCCTTGGGGTTTGGGGGCTTGACCTGGGTGC
GCTTTCTGGACAGACTTTACAGCCCCGGGGGCACAGTCGTAGAGAGGGGGCGGGGCGGCC
ATTGGGGCTCCTCATTGGGGTGCTTGGGGCGCACCCCATCGGGTACCGGGCGTCCCGGAA
TTGTGGGGGACAAAAAGGCTCTGCAGTCTCGGCTGAGGGGTCTCACCGACAAAAGAGGGG
AAGCCGGTGAGCAGAGGCTGAAGAGGGTGGGGAAGCAGGGGAGCTGTGCGTGTGTCGGGG
CGGGTGGAACCTTAGCGGACCCTGGGAGGAGGCTCCCCGGCCGAACCTGCCCGACCCTCC
CTCCCCCGGCTTGCCTTGCAG