$100,000 Bio Hunt
Sequence ID:ENST00000508793
Seqence Name:17:7661779:7687550:-1
Based Sequence (Protein):MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP
DEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK
SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQ
Compared Sequence1 (Intron1):
No alignments
GTGGGGAAGGGTGGGGGCCAAGGGGGTGTCCTTCCCCATACAGAGATTGCAGGCTGAGAA
TGACTATATCCTTGTTAACAGGAGGTGGGAGCAGGGCACGGTAGCTCACACCTGTAATCT
TGGCACTTTAGGAGGCTGAGGCGGGCCGATCACCTGAAGTAAGGAGTTCGAGACCAGCCT
GGCCAACATGCAAAGCCCTGTCTCTACTAAAAATACAAAAATTAGCTGGGTGTGGTGGTA
CTCGCCTGTAATCCCAGCTACTCGGGAGACTGAGGCAGGAGAATGGCTTGAACCCGGAAG
GTAGAGGTTGCAGTGAGCTGAGATCATGCCACTGTGCTCCAGCCTAGGTGACAGAGAGAG
ACTCCATCTCAAAAAAAAAAAAAAAATACAGGAAGGGAGTTGGGAATAGGGTGCACATTT
AGGAAGTCTTGGGGATTTAGTGGTGGGAAGGTTGGAAGTCCCTCTCTGATTGTCTTTTCC
TCAAAGAAGTGCATGGCTGGTGAGGGGTGGGGCAGGAGTGCTTGGGTTGTGGTGAAACAT
TGGAAGAGAGAATGTGAAGCAGCCATTCTTTTCCTGCTCCACAGGAAGCCGAGCTGTCTC
AGACACTGGCATGGTGTTGGGGGAGGGGGTTCCTTCTCTGCAGGCCCAGGTGACCCAGGG
TTGGAAGTGTCTCATGCTGGATCCCCACTTTTCCTCTTGCAG
Compared Sequence2 (Intron2):
Algin to intron2
GTGAGTGGATCCATTGGAAGGGCAGGCCCACCACCCCCACCCCAACCCCAGCCCCCTAGC
AGAGACCTGTGGGAAGCGAAAATTCCATGGGACTGACTTTCTGCTCTTGTCTTTCAG
Compared Sequence3 (Intron3):
Algin to intron3
GTAAGGACAAGGGTTGGGCTGGGGACCTGGAGGGCTGGGGACCTGGAGGGCTGGGGGGCT
GGGGGGCTGAGGACCTGGTCCTCTGACTGCTCTTTTCACCCATCTACAG
Compared Sequence4 (Intron4):
Algin to intron4
GTCAGTTGCCCTGAGGGGCTGGCTTCCATGAGACTTCAATGCCTGGCCGTATCCCCCTGC
ATTTCTTTTGTTTGGAACTTTGGGATTCCTCTTCACCCTTTGGCTTCCTGTCAGTGTTTT
TTTATAGTTTACCCACTTAATGTGTGATCTCTGACTCCTGTCCCAAAGTTGAATATTCCC
CCCTTGAATTTGGGCTTTTATCCATCCCATCACACCCTCAGCATCTCTCCTGGGGATGCA
GAACTTTTCTTTTTCTTCATCCACGTGTATTCCTTGGCTTTTGAAAATAAGCTCCTGACC
AGGCTTGGTGGCTCACACCTGCAATCCCAGCACTCTCAAAGAGGCCAAGGCAGGCAGATC
ACCTGAGCCCAGGAGTTCAAGACCAGCCTGGGTAACATGATGAAACCTCGTCTCTACAAA
AAAATACAAAAAATTAGCCAGGCATGGTGGTGCACACCTATAGTCCCAGCCACTTAGGAG
GCTGAGGTGGGAAGATCACTTGAGGCCAGGAGATGGAGGCTGCAGTGAGCTGTGATCACA
CCACTGTGCTCCAGCCTGAGTGACAGAGCAAGACCCTATCTCAAAAAAAAAAAAAAAAAA
GAAAAGCTCCTGAGGTGTAGACGCCAACTCTCTCTAGCTCGCTAGTGGGTTGCAGGAGGT
GCTTACGCATGTTTGTTTCTTTGCTGCCGTCTTCCAGTTGCTTTATCTGTTCACTTGTGC
CCTGACTTTCAACTCTGTCTCCTTCCTCTTCCTACAG